SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U6DJU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U6DJU5
Domain Number 1 Region: 5-74
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000129
Family DEATH effector domain, DED 0.012
Further Details:      
 
Domain Number 2 Region: 90-134
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000141
Family DEATH effector domain, DED 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U6DJU5
Sequence length 135
Comment (tr|U6DJU5|U6DJU5_NEOVI) CASP8 and FADD-like apoptosis regulator {ECO:0000313|EMBL:CCP82168.1} OX=452646 OS=Neovison vison (American mink) (Mustela vison). GN=E9PAP3 OC=Mustelinae; Neovison.
Sequence
MSTEVIHQVEEALDEDEKKMLLFLCRDVAADVAPLNVRDLLDILSERGVLSAMGLAELLY
RVRRFDLLKRIFKMDKRAVEAHLLRHPGLISDYRVLMTEIGGNLENSDLSSLFFLMRDYL
GRRKVAKDKSFLDLV
Download sequence
Identical sequences U6DJU5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]