SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U6DU95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U6DU95
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-27
Family SH2 domain 0.00000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U6DU95
Sequence length 124
Comment (tr|U6DU95|U6DU95_NEOVI) SH2 domain-containing protein 1A {ECO:0000256|PIRNR:PIRNR037828} OX=452646 OS=Neovison vison (American mink) (Mustela vison). GN=SH21A OC=Mustelinae; Neovison.
Sequence
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSETVPGVYCLCVLYQGYIYTYRVSQTE
TGSWSAETAPGVHKRFFRKIKNLISAFQKPDQGIVIPLQYPVEKKCSQGATGRREDPDVF
LKAP
Download sequence
Identical sequences M3XQI6 U6DU95
ENSMPUP00000001336 XP_004762078.1.14098 ENSMPUP00000001336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]