SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U6MGT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U6MGT1
Domain Number 1 Region: 15-104
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.62e-21
Family Chaperone J-domain 0.0005
Further Details:      
 
Domain Number 2 Region: 159-269
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.19e-16
Family PDI-like 0.011
Further Details:      
 
Domain Number 3 Region: 431-513
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000159
Family Thioltransferase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U6MGT1
Sequence length 538
Comment (tr|U6MGT1|U6MGT1_9EIME) DnaJ domain-containing protein, putative {ECO:0000313|EMBL:CDJ63226.1} KW=Complete proteome; Reference proteome OX=51315 OS=Eimeria necatrix. GN=ENH_00036470 OC=Eucoccidiorida; Eimeriorina; Eimeriidae; Eimeria.
Sequence
MHNAAAAAAAAAARKSKDYYQLLGAYRKLAKKLHPDVAPGKEKEFMEIAKAHEVLSDPEQ
RKKYDTFGEEGLAGFPGAGAGDGGFPFSEFVNLFSGAAGGFGGGPRGQGAPKMKFEFSGE
MPEYLKGFGFGFGKQQQQQQQQQQQQQQEPDWDADLYQDIEFVQELNPNNYQQQISERDH
LLLVEIYNPHCEPCRVFKMEYATAAQRLHNVVPFAAINCRSHRQLPLCRKGKRYPSVFFF
SEDKTAEPILYKGKSKFEDILAFISDKVAKHQTTLTHENMEDWLTRNPQKTKVVLFARKR
PAPPEWYLGAFFFKSQLDIGIIFPSEKDLILDYFKDPTKFNNLHAVTYLEVPSLLVVSDL
DTLQGEWRKVRGMAPDKFISTLASVANQARLPRPKTLHPLTPRRMRAGECTPQDSQICVL
LLLPSKTAAWGSAREVYSSLKELAGKYKTDPVKLVYVAADKNPVFAAAFGFSPSSKEEMV
IAYRPKRRRYLRLEPPVTKQGLEEFVDRVIGGAPLPEKLRGEPLLGAAEAEAGSHDEL
Download sequence
Identical sequences U6MGT1
XP_013440588.1.101860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]