SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3Z102 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3Z102
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-47
Family Nuclear receptor ligand-binding domain 0.0000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V3Z102
Sequence length 189
Comment (tr|V3Z102|V3Z102_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO84208.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_184265 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MHKTIQDVVIFAKKIPGFTGLDQDDQISLIKGGCFEVTCVVCAPFVDNDSNTIYLLGNGT
LITREEMKIGFPLGEHFVELLFNLCNRFNAFHLLDSEKALFSALVMISPDRPGLKNRDKV
CKLQEMLIQALQFEISDCHPDEVGLFPRLLMSISSLRELGVEHRRMLESLKGQMSFPHDL
YAETFDLVP
Download sequence
Identical sequences V3Z102
jgi|Lotgi1|184265|estExt_Genewise1.C_sca_80561 XP_009065329.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]