SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3Z5Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3Z5Y8
Domain Number 1 Region: 113-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000415
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V3Z5Y8
Sequence length 529
Comment (tr|V3Z5Y8|V3Z5Y8_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO86193.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_235547 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MRISHTSEERLGRDMMGEINSLKWSEIGGDSPLRSEIARKQTLSATIISSMYKRYQLFLF
GVVYTIGTTSGDFVCLRTGVGCTDDGNKCEANGTCTCTTGSGYDCGLNAETLSNECTESC
QNGGSCFKKDSTVGCYCTTDYYGPFCQFKRVSVKCNESGMVVNVNPHGTFQGNIFVFGLQ
NNASCNLVNIPANQVQGADPGWKGLAQYLPYNNSCGDAQISVNDTMGVYEFKIVTAYNKL
LVTSLDELITAKCFIQTGGQISISSDVELSNYGSDLKSTGSVEETFSPIEFKLLTNNTEK
KSVKLGDVVSLQFQLSTQSDLNAIRLESCVAETNQGNSLSLVSNGCRTKDAEQLISDEAS
GEPERSGNDSIVTFKITAFKFIKSNQVNFRCIVMACKDGDTKCEKQCITDSISTRRKRDT
ITVRKQVMRSLIITDGTNLDSSVDEADQCLSREQLNNLSYNDDSSPTSCFELTEVLAVIV
TLSVVLVLIMITVTLLSVRYIRNRQSKVDNLHFKDDRPTFTIPRASVAT
Download sequence
Identical sequences V3Z5Y8
XP_009063152.1.39240 jgi|Lotgi1|235547|estExt_fgenesh2_pg.C_sca_660064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]