SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZC53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3ZC53
Domain Number 1 Region: 77-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000519
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V3ZC53
Sequence length 238
Comment (tr|V3ZC53|V3ZC53_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO88628.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_234476 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MLSIRVLGVFAVIVVALVLVESDVEHCEDDVNVCDGELPANAVCSGENNKTKQCQCKKGY
EMSLDIDCKSRGSVFSCQDIDECATNNGLCEDKCQNEPGSYNCSCPEGSELQENGLNCGP
GPCMFEKVTATGLAKGFNRIYISIENETECEKKCNTTAECTDWLHLGGSCRNYGLPIIQI
EYFPNKDLDKCKKLCAENKKCVTFYYSAICTLFDTKQTEFDDDDESSDIFHKIDMNCI
Download sequence
Identical sequences V3ZC53
XP_009060676.1.39240 jgi|Lotgi1|234476|estExt_fgenesh2_pg.C_sca_510090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]