SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZD78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3ZD78
Domain Number 1 Region: 77-339
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-46
Family Nuclear receptor ligand-binding domain 0.0000934
Further Details:      
 
Domain Number 2 Region: 4-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-27
Family Nuclear receptor 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V3ZD78
Sequence length 343
Comment (tr|V3ZD78|V3ZD78_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO81982.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_135497 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
RLLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHKNRAYTCKAQGEMKGMCPIDKTHR
NQCRSCRLKKCFDADMNKDAVQHERGPRKPKLKGTDLSLGHHHNQHGHHRQVTQEVPIDL
RVTSSPKNTFPLPQDCITNIASNPNVWHEVMARLLFTIIGWVKQIPAFMILTEADQVILL
TTSWKDLFLLGIVQWGLPVDVNGIHRSINFLGNVGEMNPTTELDRLTETIARLREMALDP
TELTCLKAICLFKSGKEVNHADGTNLVDVKTVENLQEQAHLMLTEHIQLQYPRQMVRFGR
LLMLVSKLQTLKPSFIERVFFRTIVGNISIEKLVGNILQGDLV
Download sequence
Identical sequences V3ZD78
jgi|Lotgi1|135497|e_gw1.98.66.1 XP_009067287.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]