SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZDF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3ZDF9
Domain Number 1 Region: 220-460
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-52
Family Nuclear receptor ligand-binding domain 0.0000116
Further Details:      
 
Domain Number 2 Region: 86-169
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-26
Family Nuclear receptor 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V3ZDF9
Sequence length 469
Comment (tr|V3ZDF9|V3ZDF9_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO82067.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_170342 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MHGHHLEAYLDISPPPSPAMGKVVSEGDMPPDVHQSQFSVFDHQITNNVSQDAYTFHSED
TKYSDVMATDVKRKKGIGVAGKSIEEELCRICGDRASGYHYNALSCEGCKGFFRRSITRG
ATYSCRYGGNCEMDMWMRRKCQACRLRRCKECGMKEECLLSDEQCKARDARRKAKAKVNP
VKTEPIPDSNGLSPESKQRSVGDRNGGTQSVYTNPLTVINSNPMNKVAHHHRQLIEEVCR
LQDKYEFPDEADVDKATCVKPDMKEVTADAMFRDMAEMTVLITNLIVEFAKSLPGFTSLS
KADQIVLLKAASSEVMAIRAARCYDLETRCIVFANGVPCTLENMKATGMGEYAELTYQFC
HNMAVMETDNAEYALLTAISIFSERPGLSEKDRVEEVQYRYVSALESYEHIKRHKGACSF
GRILSLLPDLRSISAEHSKTIVEISQQSSHMPGDYCEVKDIYVDPPEGT
Download sequence
Identical sequences V3ZDF9
XP_009067232.1.39240 jgi|Lotgi1|170342|fgenesh2_pg.C_sca_97000025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]