SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZDU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3ZDU1
Domain Number 1 Region: 103-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000871
Family EGF-type module 0.056
Further Details:      
 
Weak hits

Sequence:  V3ZDU1
Domain Number - Region: 41-77
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Pan module (APPLE domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V3ZDU1
Sequence length 144
Comment (tr|V3ZDU1|V3ZDU1_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO82217.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_170260 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MKLFFGIVLMNLGLVAVDCGQRFWRMKECDHKRFQLGDTPELKSKTKYHCVKMCQDEAEC
LTIFFDGTHGRCYKFDKLPKSTCHNLVEYYSGKNHEFLYKGIQCKNGGTASEDKLNCQCV
NDWSGRFCEIPKDSNEEDEKEDAY
Download sequence
Identical sequences V3ZDU1
XP_009067132.1.39240 jgi|Lotgi1|170260|fgenesh2_pg.C_sca_95000056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]