SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZFP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V3ZFP4
Domain Number - Region: 142-216
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0408
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 42-116
Classification Level Classification E-value
Superfamily Prefoldin 0.0811
Family Prefoldin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V3ZFP4
Sequence length 345
Comment (tr|V3ZFP4|V3ZFP4_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO82912.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_109065 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MKIAYSISLICLHEFDFTFQYQVCRCKLDSKCEALLILSKELDQCRSERDQFKLMAEQLR
ERYQAIKRQMTGRSLVQLLCDTKEVKKSLKFEVDDLKQKLNDAQGDIKLLREQIARQRVG
STDEGMTTRHFPAYEREDLVKQLEASREQYLQLEHDLQQLLDEKEDQETELDAYKSKYEN
LNRELNYILKGDEKRIVDIDALVAENKFLNERLKQMEEEKSMAMATASKYKSILERRKNK
GILKFGQSRSGGLVITQKQVGQMLHNPTGMPSTPQAMADLQGLCGALLDTINDKNLALSH
QRKTNKLLGSRVSELEKKLKTLEVAGLWNVPGMILFICSCKSYCP
Download sequence
Identical sequences V3ZFP4
jgi|Lotgi1|109065|e_gw1.9.243.1 XP_009066700.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]