SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZGW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3ZGW6
Domain Number 1 Region: 205-257
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 5.13e-16
Family Ovomucoid domain III-like 0.0061
Further Details:      
 
Domain Number 2 Region: 1-70
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000036
Family Ovomucoid domain III-like 0.0056
Further Details:      
 
Domain Number 3 Region: 501-560
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000222
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 4 Region: 595-663
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000624
Family Ovomucoid domain III-like 0.0085
Further Details:      
 
Domain Number 5 Region: 264-331
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000139
Family Ovomucoid domain III-like 0.0068
Further Details:      
 
Domain Number 6 Region: 816-886
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000388
Family Ovomucoid domain III-like 0.0084
Further Details:      
 
Domain Number 7 Region: 447-496
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000513
Family Ovomucoid domain III-like 0.007
Further Details:      
 
Domain Number 8 Region: 114-188
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000873
Family Ovomucoid domain III-like 0.0039
Further Details:      
 
Domain Number 9 Region: 361-427
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000107
Family Ovomucoid domain III-like 0.0073
Further Details:      
 
Domain Number 10 Region: 709-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 11 Region: 763-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V3ZGW6
Sequence length 887
Comment (tr|V3ZGW6|V3ZGW6_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO90468.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_71215 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
CRGHFCAFGAVCMVNKTDNTAYCQCTNKCQPVFTPVCGTNGVTYASECLLEKTSCTTQRR
IKIKSPGECDKIFAQICFHIIYLYFLTVISKNKLVITIATASDFQIWPRIPNPCEGKLCR
FGATCKLSIDGTEGRCVCPPRCDSYGDSLGSTPVCGSNGVDYKNMCELHRAACSGMRNIR
VKYYGKCDPCSKHKCILPQICQLNEQRKPVCKCEFRCHDDFEPVCGSDGRTYSNECLLRR
EACKSRKEITVTYNGKCSTGDNPCDNIRCGPEEECSIDRQGRASCICPNPCEPVMRQVCG
NDSMTYDNECELRRKSCLTKKYVTVAHTGVCGKFSKCLKHGPFCDVNNIICIFFTGGDVP
CRNYRCDYDAECIENEGKPSCECRSCNEQYDPVCGDNGITYENECKLRYENCKFKLTVGI
KHRRSCNGCENVKCEFYAICESNGNQAKCVCPTSCIPVEAEVCGSDGQSYLNECELKVAA
CERKQFISIASTGSCNKCADVVCKYGAKCENGICVCPIMCPTTRETVCASDGNIYSNECE
MRRASCAQSVDLDIVPSDRCQDEIHSGSGSSGERALPPSWADISEGSGDLIMTSCDETTC
KYGGKCVQDDDGDGICYCHDNCDALRAPVCGSDGRNYGNECQLKYESCRQQKEISIFPDD
SCDAIILHLVSYFISEKQIKLCSDTKYGCCQDGKTVAPGPSRSGCPEYCHCNVLGSYGST
CEPQTRQCTCKPGVGGLRCDRCQPGYWGLHKIIEMGNQGCIPCGCDYYGSIRDDCDQMTG
RCMCKTSINGMKCNLCSDGNQLGPLGCEDDNRPKSCRDMVCKFGAICEESHGRPECVCDQ
MCDESEARRDIVCGTDGQNYGSECQLEMFGCRLQKDITVAYRGPCRG
Download sequence
Identical sequences V3ZGW6
XP_009058749.1.39240 jgi|Lotgi1|71215|gw1.43.92.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]