SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZKV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3ZKV5
Domain Number 1 Region: 112-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000991
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 2 Region: 33-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000242
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  V3ZKV5
Domain Number - Region: 3-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000245
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 74-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V3ZKV5
Sequence length 156
Comment (tr|V3ZKV5|V3ZKV5_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO84897.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_70871 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
SESCDSNHVCHVDRDVVTCKCKTGYRGLQCSEDINECTDLSIDCNTGQCINTPGSFSCQC
QNDFTGGCQNGPVPCDKNNCNPLNTANCINTGTTTSRCECKPGFKGATCGESIDSCDSNP
CIHSQRCDNLVNDYTCICEAGWTGRRCETLIDTCSS
Download sequence
Identical sequences V3ZKV5
jgi|Lotgi1|70871|gw1.7329.3.1 XP_009064415.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]