SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZMY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3ZMY0
Domain Number 1 Region: 48-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000263
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  V3ZMY0
Domain Number - Region: 4-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000285
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V3ZMY0
Sequence length 96
Comment (tr|V3ZMY0|V3ZMY0_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO85672.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_107831 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
CNDNVDECSASDKNDCASNTDCKDTDGSFIYGTCTCKDGWAGATCNDNVDECQQTTTCNS
VPNSKCEDLQGSFNCKCNAGYVKVNDKCEGRLYFRS
Download sequence
Identical sequences V3ZMY0
XP_009063910.1.39240 jgi|Lotgi1|107831|e_gw1.7.53.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]