SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZN70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3ZN70
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000487
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 119-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000196
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 3 Region: 319-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000429
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 4 Region: 195-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000393
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 5 Region: 157-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 6 Region: 233-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000398
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 271-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000219
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V3ZN70
Sequence length 355
Comment (tr|V3ZN70|V3ZN70_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO83875.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_72805 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
DIDECVSSPCKNDGQCNNELDRFSCSCQSGFTGIFCEVNIDDCDGVLCQSRNATCKDLVN
NHQCVCKDGFTGTDPNCIDINECASNPCVQSQTIRCDNLINKYHCQCVPGYTGERCEIDI
DECQIDPCQNNATCVQDINSYRCICLPGYNDKNCSNNINECLTDICRNGGTCTDLVNDYK
CDCITGWTSKDCSVNYDDCSSNPCLNNATCHDYLNYYNCSCLTGFRGFTNTNCSLNIDDC
AFHNCSSFQQCYDGVNSFTCGCPPGYEGSLCDIDIDECAGNRCQNNAKCINGTGDYTCEC
QLTLYNLTQYVPGSDCGLNINECESDPCQNMGTCLDGINGYNCSCIPGITGANCE
Download sequence
Identical sequences V3ZN70
jgi|Lotgi1|72805|gw1.80.111.1 XP_009065403.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]