SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZP81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V3ZP81
Domain Number - Region: 83-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00761
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V3ZP81
Sequence length 222
Comment (tr|V3ZP81|V3ZP81_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO93208.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_232671 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MSHVNYIVLLLVMIVHVNCQILPSNIGTIKADLEKGGRAVCKYCYGCMFTGLCGASCSGN
TMCELCSFKTHCDTTCVGLCQQPDPCATSPCPDNKICQELTNGGRAYRCVCQEGKVCEKT
TNSWETQSIFAKWNPTKRVTQEITNRPTTEKIITTPSPTTSRTQEYPTRQPSDKNLLTSR
NPFLAGTLTSPSLTSPVDNSQHNHGTAKPSYSTTGLPGYWFY
Download sequence
Identical sequences V3ZP81
jgi|Lotgi1|232671|estExt_fgenesh2_pg.C_sca_310003 XP_009055914.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]