SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZRS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3ZRS8
Domain Number 1 Region: 69-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000867
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V3ZRS8
Sequence length 189
Comment (tr|V3ZRS8|V3ZRS8_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO87047.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_154532 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MLLKGFFSIMQIFVNTSEIIIHYKKHCTMEGCGRTPNKPQHSTASPLDSHITTEIPTHRH
PCTDAEVKIAKCFNGGECYALEIHENRSVNCLCPKLYRGSRCEEISPDIFGELQTGGKVV
IGGVAAGVCVIILIIVIVIVYYVIKIRKKRREERSHRNENGVQGETLLQQNIINHNHTKN
GIHNKETNV
Download sequence
Identical sequences V3ZRS8
XP_009062002.1.39240 jgi|Lotgi1|154532|fgenesh2_pg.C_sca_6000035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]