SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZUY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3ZUY1
Domain Number 1 Region: 69-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000355
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  V3ZUY1
Domain Number - Region: 41-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.062
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V3ZUY1
Sequence length 234
Comment (tr|V3ZUY1|V3ZUY1_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO88177.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_234725 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MLSIRVLGLFAVIAIALVLVESEFSEVCYGELPANAMCSVENNKTRRCQCKEGYEMDIIC
TSNGSIFSCQDIDECATNNGSCEFKCQNEPGSYNCSCPEGSELQENGLNCEPIKPGPCMF
ENQTVTGVSQNFNRTYIGNENETECEKKCNTTVGCTDWLILDGHCQNFGLPIIQVELIPD
GSPEKCKDLCAQNKKCVTAQYFVTCTLFDTKQTEFDDGCDPETVFHKIDMNCLN
Download sequence
Identical sequences V3ZUY1
XP_009061202.1.39240 jgi|Lotgi1|234725|estExt_fgenesh2_pg.C_sca_540097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]