SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZXP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V3ZXP5
Domain Number - Region: 47-163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000408
Family Growth factor receptor domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V3ZXP5
Sequence length 207
Comment (tr|V3ZXP5|V3ZXP5_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO87365.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_175958 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MTVQWVSKPGYKEDDCTRVCATGTYGSECNNFCHCLNYDKCDVITGQCPNGCQTEWYGGN
CNTSCQSGKYGDRCSKLCNNRHCKRSQECHHITGQCTDGCKPGYKGYDCTLSCPNGAYGD
KCSKLCNNRHCKGSQECHHITGQCTDGCKPGYRRNDCIKKCQKRAYGDICSKGCDNRQCK
GSQHCPHITGKCYNGCTPGYREDDCTV
Download sequence
Identical sequences V3ZXP5
XP_009061946.1.39240 jgi|Lotgi1|175958|fgenesh2_pg.C_sca_591000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]