SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZZ20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3ZZ20
Domain Number 1 Region: 28-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V3ZZ20
Sequence length 192
Comment (tr|V3ZZ20|V3ZZ20_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO87860.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_166161 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MDLRNCYERPKEYKFCESGACVLNNEYCPCSHNFFQCRFAAKCIHSSLVCNNVDDCGNNK
DEENCFKTDDAQPQECHLSTGAIIGISIGVAVVFILLVLAMLYWLHRKKRLRSQNTSSLE
PLRIQTKQSLGDVTSSEGSDVNKRNSGYNKVPLDDSFGPFNDVLCTSTPKPDARRQIVQM
DPMPPILILKPS
Download sequence
Identical sequences V3ZZ20
jgi|Lotgi1|166161|fgenesh2_pg.C_sca_56000074 XP_009061464.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]