SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3ZZQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3ZZQ6
Domain Number 1 Region: 40-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 1-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000898
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V3ZZQ6
Sequence length 75
Comment (tr|V3ZZQ6|V3ZZQ6_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO97038.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_60252 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
DECASVPCQNGGWCIDTTTSFRCHCEGSRYIGTNCEIDTVNDCVSNQCKNGATCNDGVNS
YTCSCKPGYTGNLCD
Download sequence
Identical sequences V3ZZQ6
jgi|Lotgi1|60252|gw1.2098.1.1 XP_009052274.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]