SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4A0R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4A0R9
Domain Number 1 Region: 9-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000189
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4A0R9
Sequence length 59
Comment (tr|V4A0R9|V4A0R9_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO88520.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_145864 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MIYLSPFWKYKSIVDINECMEGGARCHKDAGCLNNKGSYNCICSGEFYGDGKNCRGWYK
Download sequence
Identical sequences V4A0R9
XP_009060791.1.39240 jgi|Lotgi1|145864|e_gw1.518.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]