SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4A209 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4A209
Domain Number 1 Region: 56-225
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 4.32e-23
Family Fibrinogen C-terminal domain-like 0.00068
Further Details:      
 
Weak hits

Sequence:  V4A209
Domain Number - Region: 27-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4A209
Sequence length 260
Comment (tr|V4A209|V4A209_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO90722.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_163997 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MGTSRPPLIFVTLPSQNEQYEVEDANNDGDCVNGVFDSDGCVCTTGFAGESCNRYVYDCK
EALDTEVSLEQSLTHVMLKPKNTNLAFEALCNSNGHLAILARNTYGIDDVTFNKAWKDYQ
YPFGTVGNFWLGLEYIYAMLNQGDIFKLQIYCRNLDSEFSVFYETFSIQSESNRYQMTAG
VKLYESYTNGSDGFGGGQIDVPFCTYDRPCNGYPYYLNGGWWYVSGLEQYALTNQKPSLK
FKYQNNDISVHQVSMALVKL
Download sequence
Identical sequences V4A209
jgi|Lotgi1|163997|fgenesh2_pg.C_sca_42000204 XP_009058713.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]