SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4A5T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4A5T3
Domain Number 1 Region: 16-141
Classification Level Classification E-value
Superfamily Prefoldin 4.45e-25
Family Prefoldin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4A5T3
Sequence length 158
Comment (tr|V4A5T3|V4A5T3_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO92077.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_217219 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MAAKSPQQIDISQLPIQQLNQLAQQVEQELEFFQTSLTQLKIAQGKFVESQECMNKVTKE
NVDKEILVPLTSSMYVPGQLSNADNVLIEIGTGYYIEMSVDKGKDYFKRKVEYISKQMEK
IQPILQEKYKAKQAIVEILQLKVQAQIAAQGQSPPAKA
Download sequence
Identical sequences V4A5T3
XP_009057377.1.39240 jgi|Lotgi1|217219|estExt_Genewise1Plus.C_sca_370290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]