SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4A7R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4A7R0
Domain Number 1 Region: 32-91
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000347
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Weak hits

Sequence:  V4A7R0
Domain Number - Region: 8-33
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0574
Family Follistatin (FS) module N-terminal domain, FS-N 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4A7R0
Sequence length 303
Comment (tr|V4A7R0|V4A7R0_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO99988.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_158210 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MENWRESYLDACKNHNCPNNTVCRELQDSYNCEVIGCVGFPGVNNINSSSFEAEPLWGVN
EMVEYVCERGYFPSINPVCTEDGTWSEFVCSPYSKCGEIRNCNESMEEKDYWLYAAEYQT
RVKLFCKWGVGAFVSLQHPNMASFSEYTITGTDCATSPLDNPETKGAGTTEFQKIKLQIL
KGYKIIVYIHFVTNSSLNPKDYGSAKDCYPKDNGCGVLGKFVIDTRRTGFKFPDSLTWKT
VGTSAVIGNITRSMGGHVITGFCGGDCGGCEIDETGNGTYLQIDINDMPPFESAELPLCQ
FLV
Download sequence
Identical sequences V4A7R0
XP_009049425.1.39240 jgi|Lotgi1|158210|fgenesh2_pg.C_sca_16000178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]