SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AA30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V4AA30
Domain Number - Region: 67-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00312
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 27-62
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00779
Family Complement control module/SCR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4AA30
Sequence length 171
Comment (tr|V4AA30|V4AA30_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO91910.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_175748 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MATNIIKIKFTGCSTYPNITDANFDKDCNGNVVITCNEGFKMVQGLECVEEEWRYQNPIC
KRTVIIPDCKNGGTLVEENGKFKCNCPLNTFGDDCNCRYKYSNVKSLTPRAYAERTVSDS
AKCDENCANDTKCSTSTTWLGTCLRYKTPIIFVSLDGKEDQCIEKCNEMSE
Download sequence
Identical sequences V4AA30
XP_009057401.1.39240 jgi|Lotgi1|175748|fgenesh2_pg.C_sca_376000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]