SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AAJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AAJ8
Domain Number 1 Region: 35-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000339
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  V4AAJ8
Domain Number - Region: 123-179
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0377
Family Anti-platelet protein 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4AAJ8
Sequence length 199
Comment (tr|V4AAJ8|V4AAJ8_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP00999.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_238373 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MCSGENNKTKRCQCKKGYKMSLDIDCTSNGSVFSCQDIDECATNNGSCEYKCQNEPGSYN
CSCPEGSELQGNGLNCGPSGPGPCMFENATVTGVSINFNRIYIGRENETECERRCNTTVG
CTDWLRAFEFCRNYGLPILQFEFLSIRSVDMCKKLCAQNKKCVTAQFREACTLYDSKQTE
FVDDGEPQTVLHKIDRNCT
Download sequence
Identical sequences V4AAJ8
XP_009048264.1.39240 jgi|Lotgi1|238373|estExt_fgenesh2_pg.C_sca_1430001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]