SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AC55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AC55
Domain Number 1 Region: 5-162
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000235
Family Pentapeptide repeats 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4AC55
Sequence length 177
Comment (tr|V4AC55|V4AC55_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP01584.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_139522 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
NCLLSYCPLSNCLVSKCSVSYNPVSNCPVSKCLVSKYLVSKCLVSKCLVSNCPVSNCPVS
FCPMSKCLVSNCPVSKCLVSIYPVSKCLDCPVSNCLGSICPLSNCLVVKCLVNNCPVSNF
PVSNCPVSNYCLCPVSNCPMSKFLVSKCPVSNCPMSKCLVSNCLVCKCPVSNCPNVQ
Download sequence
Identical sequences V4AC55
XP_009047755.1.39240 jgi|Lotgi1|139522|e_gw1.137.78.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]