SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AC66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AC66
Domain Number 1 Region: 22-156
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000186
Family Pentapeptide repeats 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4AC66
Sequence length 289
Comment (tr|V4AC66|V4AC66_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP01594.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_139463 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MLEYKLIPIDMFEYKLLPIEMFEYKLLPIDMFKYKLLPIEMFNCKLLPIDMFKYKLLPIE
MLEYKLIPIDMFEYKLLPIEMFEYKLLPIDMFKYKLLPIEMFNCKLLPIDMFKYKLLPIE
MLEYKLIPIDMFEYKLLPIEMFEYKLLPIDMFKYKLLPIEMFKYKLIPIDMFKYQLLPIE
MFKYKLIPIDMFKYKLLPIDMFKYKLLPIEMFEYKLLTIDMFEYKLLPIEMFKYILLPID
IFKYKLLPIEMFEYKLLPIDMFEYKLLPIEMFKYKLLPIDMFKYKLIPI
Download sequence
Identical sequences V4AC66
XP_009047678.1.39240 jgi|Lotgi1|139463|e_gw1.136.57.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]