SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AEN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AEN2
Domain Number 1 Region: 4-50
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000262
Family Pentapeptide repeats 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4AEN2
Sequence length 59
Comment (tr|V4AEN2|V4AEN2_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO93605.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_119079 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
GKQLSGEHLSGEHLSGEHLSGEHLSGEHLSGEHWSGKRLSGEHLSGEQLSFTLREKVFL
Download sequence
Identical sequences V4AEN2
XP_009055799.1.39240 jgi|Lotgi1|119079|e_gw1.30.127.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]