SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AGR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AGR0
Domain Number 1 Region: 13-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.39e-16
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 2 Region: 207-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000284
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4AGR0
Sequence length 284
Comment (tr|V4AGR0|V4AGR0_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO92611.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_162527 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MTIGFQGYVHSESWTFNNPGISYIGFSPQYTSGQSQHIELKFRTRQPNGLLFHHYLLPFD
KNKFPLLYHYELYAEIRKGYLRVGHQVNQYSQLLTLGQGLNDDQWHSLSWDLDSSDGLMS
VQLDNETKSLSLEVYGWGSGKEILKWSQLPSIISFGATNKSESQEFFYFIGCLADLKYSR
EDGILIAIPIQKISGVTQGCSDLCTGSNPCQNGGRCINMYTTTKCDCFGTNYEGSKCENK
EILFSVADYFVTRLHTGPNRQTESCSCSPKSVGLLVDLSEANII
Download sequence
Identical sequences V4AGR0
XP_009056752.1.39240 jgi|Lotgi1|162527|fgenesh2_pg.C_sca_34000130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]