SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AII9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AII9
Domain Number 1 Region: 26-188
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.13e-19
Family Fibrinogen C-terminal domain-like 0.00083
Further Details:      
 
Weak hits

Sequence:  V4AII9
Domain Number - Region: 6-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00104
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4AII9
Sequence length 253
Comment (tr|V4AII9|V4AII9_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO93296.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_161862 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MVNSFYISTCENGTCLCPIGYYGNNCEHIITDCSHGHELNWSHLGQMLSFVKPSLSPEPF
EILCHFDYLGIAHALTRHSSCIPDYYNRTYSEYRQGFGDASTSHWIGLDKFYQMSKERNN
FRLNIYFYTGLSAQCYYNQFSVMDVSDQFKLQVSGFTSHSTEICSDSWTNSVNINNAPFS
TFDNDTTPNDCPNKMAADGSFSALTSPIPKVANFVSNNKSLISSEAQALGSVAKAGVNIS
DAVKNLTNLKNYS
Download sequence
Identical sequences V4AII9
XP_009055995.1.39240 jgi|Lotgi1|161862|fgenesh2_pg.C_sca_31000104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]