SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AJ33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AJ33
Domain Number 1 Region: 64-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4AJ33
Sequence length 118
Comment (tr|V4AJ33|V4AJ33_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO97077.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_239215 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MVNTVVVALFVLVAVITVSDAQIANCLTTVGCGGANRGFCDPTGAVTPGTGTCRCYRGFY
LNPTNPTLCQDINECIVYPCGRNIGRVCINTIGSFYCQYNSNSFQNLLNYYYISELLD
Download sequence
Identical sequences V4AJ33
XP_009052236.1.39240 jgi|Lotgi1|239215|estExt_fgenesh2_pg.C_sca_2070012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]