SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AJ36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V4AJ36
Domain Number - Region: 30-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000551
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4AJ36
Sequence length 120
Comment (tr|V4AJ36|V4AJ36_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO97082.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_239219 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MNYLFFSAILIASTATIYAQVNVPQCAGFQCISGTCNITVAGVPFCQCFTGFKPSNIISV
CEDIDECKQNNQLCQGFYCCNEPGAYTCSAHPCNQRNFNRRNDLSSLFFLLPFLGEAKKK
Download sequence
Identical sequences V4AJ36
jgi|Lotgi1|239219|estExt_fgenesh2_pg.C_sca_2070017 XP_009052241.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]