SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AJA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AJA9
Domain Number 1 Region: 46-218
Classification Level Classification E-value
Superfamily L domain-like 5.95e-31
Family L domain 0.00027
Further Details:      
 
Domain Number 2 Region: 197-294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000064
Family Growth factor receptor domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4AJA9
Sequence length 296
Comment (tr|V4AJA9|V4AJA9_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP04264.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_224000 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MEYTIFTLICLLSVVTCLNLKETVPHSDLECHGTSVGLGYSGSRQNHYNNLKKRYMGCTV
VHGNLEITNLDDPNIDYDLSFLSDIRYVSGYVFIGLVSELDTLELKSLEVIRGNRTYAIH
GEAYSLVVSLTSRYHSPHLGLQQLHLPALKEIVEGRVMFIGNPVLCFINTIPWYKITRLF
NSTDNHNPVYYGERAYSTNCDDCPQECSFNGASRCWGPRPQLCSKDIDYGCHSTCNGRCY
KGGEDGCCHKLCSVGCTGPTASDCYVCRDFKMEESGECVTHCPDSTYTKSQKCILF
Download sequence
Identical sequences V4AJA9
XP_009045074.1.39240 jgi|Lotgi1|224000|estExt_Genewise1Plus.C_sca_1070073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]