SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AJF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AJF3
Domain Number 1 Region: 116-348
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.85e-65
Family Nuclear receptor ligand-binding domain 0.000035
Further Details:      
 
Domain Number 2 Region: 9-98
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-29
Family Nuclear receptor 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4AJF3
Sequence length 354
Comment (tr|V4AJF3|V4AJF3_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP04319.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_136477 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
ISEFDGETVLCRVCGDKASGFHYGVHACEGCKGFFRRSIQQKIQYRPCLKNQQCNIMRVN
RNRCQYCRLKKCISVGMSRDAVRFGRVPKKEKARIIEQMQKVSSQSTSSAILSILSNEQD
VVQAVFNAHRQTCDFSQFRVQQMRELAFQDNKYVDCPTHMACPLNNQLGMDPNANKDWEN
FSESFTPAIKSVVDFAKGIPGFTLLNQDDQVTLLKAGTFEVLLVRLSCLFDPDTNTLMFT
GGRLNCVLVFQISCGAGFLLDSMFDFAERFNKLNLGDEELALFSAIVLLSPDRPGLRNLE
QVEKIQNALTESLHNIININYKEDNTMFAKLLMKTTDLRTLNTLHSEKSIGRYN
Download sequence
Identical sequences V4AJF3
jgi|Lotgi1|136477|e_gw1.106.5.1 XP_009045016.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]