SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4ALA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4ALA0
Domain Number 1 Region: 127-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000548
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 3-33
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000274
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  V4ALA0
Domain Number - Region: 59-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000102
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 97-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000433
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 33-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4ALA0
Sequence length 173
Comment (tr|V4ALA0|V4ALA0_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO94351.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_118680 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
CPTPCLNSGVCESNGRCRCILGYKGDHCQHAICKEGCKNGGRCVSPGKCECPVGFSGPDC
KPYCAQTCHNGGECVRTNVCKCPKGYTGADCSQPVCSLGCFNGGKCVAPEKCSCPRGYRG
QYCHKAKCRSKCLNKGKCVSPNTCLCRKGYSGPRCEHCKYLSHSISFQLLHNP
Download sequence
Identical sequences V4ALA0
jgi|Lotgi1|118680|e_gw1.29.177.1 XP_009055191.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]