SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AMV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AMV2
Domain Number 1 Region: 95-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000479
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  V4AMV2
Domain Number - Region: 125-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 61-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000329
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 155-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0243
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4AMV2
Sequence length 184
Comment (tr|V4AMV2|V4AMV2_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO96100.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_160085 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MGSFKVYVSMVSMFVLIAMLNSSSSYRYSSRYSSRSRYNYQPSLRKCLSNDIISTLQGTL
CPKANPCKNGGTEQPSGRCVCTDEYTGPTCEEKVNPCKNGGIDLPSVGCVCTFDFTGSTC
EERVNPCQNNGTLLSDGSCNCTVDFTGTLCEDIVNPCQNGGTERLNGTCDCTQFYAGDFC
GQYN
Download sequence
Identical sequences V4AMV2
XP_009053215.1.39240 jgi|Lotgi1|160085|fgenesh2_pg.C_sca_23000103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]