SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4APP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4APP8
Domain Number 1 Region: 931-1196
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-46
Family YWTD domain 0.00000222
Further Details:      
 
Domain Number 2 Region: 1569-1803
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-41
Family YWTD domain 0.0000392
Further Details:      
 
Domain Number 3 Region: 192-455
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-40
Family YWTD domain 0.000021
Further Details:      
 
Domain Number 4 Region: 1249-1508
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-33
Family YWTD domain 0.0000873
Further Details:      
 
Domain Number 5 Region: 2-133
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-22
Family YWTD domain 0.00018
Further Details:      
 
Domain Number 6 Region: 627-669
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 752-787
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 8 Region: 510-544
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 712-749
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 590-624
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 11 Region: 1525-1572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000174
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 12 Region: 671-708
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 13 Region: 809-824,862-920,1516-1564
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000108
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 14 Region: 461-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000347
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  V4APP8
Domain Number - Region: 1201-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000197
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1892-1948
Classification Level Classification E-value
Superfamily YWTD domain 0.000288
Family YWTD domain 0.01
Further Details:      
 
Domain Number - Region: 1834-1883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00108
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 548-584
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00288
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4APP8
Sequence length 1951
Comment (tr|V4APP8|V4APP8_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO96765.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_51280 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
RFLFFADWSMEAKIERTNMDGSDRHKLVIKKIVHPNGLALDYVNKHVYWADSFLDYVERV
DYDGHNRRVIAIGENVDHVFGLTLFENYLYVSNHHNNSIVRVHRFQQNNMTVINRQTLTK
PSDIHIIHPVKQPQVSENVCGKKKCDHICVPVPHTDNQNVQASCMCRSGYTLVNGNNCRK
NKDSIFLLYANAQQGNIQGISKDDEKSKQVIEPIINLNRPMAIAYDNKTSYIYYSDVSLL
HIGRRKAFTTDAEPEKFLDTGVTSSEGLAIDWIGRNLYWTDDGHKTINIVRLTDTTKRYT
VIRNLNHPKAIVLDANKGYMYWTDWVLKPSENIKSRIVKAEMNGQNNQTLVETNIQWPNS
LTLDYTTQMIYWTDAYYDRIEKISTNGDPTTRTVIVSFKHLNHPYGIAVFENYVFFTESL
SGQVKRFNMVTKDTVVIRNDSNPLFDLQLYNPQQQVIQGEKDCAVNNGGCTDICVTVPSG
SVCICSDDRLLQSDKKTCKANPNYKPPAPCNKDREFTCKDESCINILWKCDGERDCLDGS
DEDHNVPCETFQCQKSENKPCLKEEQLRCDGEIDCPNGEDEEGCGSKSRDCQANYTSCGT
TSNRCIPSAWVCDKEADCVDGSDEDAAKCDTAKCVADQFQCAYGHCIPYMYRCDNEYDCP
DHSDELDCTNWCDPLKEFSCADKITCIKKHFVCDGIRQCKDGSDEEQCNKKICHDKEYQC
KNGECIIQVWKCDGDFDCSDQSDEDKDMCQTRSCYSTEFKCNSTNQCIPGAWKCDGDEDC
GDGSDEHVSQSLECSYPNFKCVVKQKEVCLSPVKYCDGVLDCDDHSDEPRSLCSVKVCQD
HECSHFCHSAPAPPGDFYRYVCSCPENQHIGSDNKTCQKTDVCSQWGICSQLCVADISKP
DGYRCLCKDTYTLQLDGFSCKPNGKYKTIHLIYSNRHEMRRVDLGEKSYVSLVAGLRNTI
ALDYHYKKQYIFWTDVIEDKIFRGKMIQNTLTNLKTIVNVGLATTEGLAVDWISNKIYWV
ESNLDQIEVAEFNGTNRRTLIAGNMTSPRAIVLDPRYGALFWSDWDGRFPRIETCSMSGK
GRKVLFDVRSNFDLGGWPNGMTLDYEVNRIYWVDARSDSLHSMTYEGKDHRLILKSHEYL
AQPFSVSVFEHYVYWTDWRTNSVLRANKFNGSDVTEIQKTFTQPFDVQVFHPNRQPDAYN
PCEIQNGGCSHLCLIGFPDKTGNTTADCQCPHRMKLNADQHSCDEDNKFLIFVKKNEIRG
VDLQHANYNVIPSITVRFVENSTSTATAIDYDLKEQRLYWTDEARNVINSASLNGSGVET
VIDSGLSNPKGFAIDYLSRNMYFSSYNKDKDSSTISVAKLNGAFRTEIISQNLKQLNSLA
IHPGKGLMFWSDVGGSQHKIIKANMDGSDQRVLVNNTFKPASLTVDTRSHALYWINQEKS
TIHRCPLDVLLGQCEKLNVSFDDNLLVSMTIFEDEIYVYSSDKKNKSANSIMRIDKSYKK
VVMRTNTPDISAIQIYNTERGKDGSNGCSKDNGGCSQLCLPTHTARICKCTAGFKLADDQ
TSCHGITSFMLYSTESDIQGFTLETPSQVALASISKISLASAIDFHAEADYIYWVDSNAR
AISRIKRNLTQREEIINKGLNSIEGLAVDWVANHIYWTDRSHNTVEVAKTDGSNRYVLIH
EGLDNPTSIVVHPRNGMLYFIDQGKYPVIMQAKLDGSDLKALIDSNMVRPRGLTIDYDTD
MLYWCEEDSDKIDKIVSYDFNTQEQVNHVVPGLTACVSLTIFKDYIYWADKTDGNGSIKR
TNKTLTSTDVQYLRKNLTDKLKHVQIFDADRQRSHNICLKNSYNCAELCLYQGSGHASCI
CSYGRLKLNGRDCEAYTEFLMFSKVTGIDSVSMSRIPSKNPPFKPITNETMQNVIGLAYD
YKGNRLYFSDIQRGDIQSVSFNGSDLQIVKE
Download sequence
Identical sequences V4APP8
jgi|Lotgi1|51280|gw1.211.2.1 XP_009052540.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]