SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AQF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AQF9
Domain Number 1 Region: 230-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-23
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 2 Region: 107-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-21
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 3 Region: 285-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 183-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 149-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000276
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  V4AQF9
Domain Number - Region: 4-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00644
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4AQF9
Sequence length 336
Comment (tr|V4AQF9|V4AQF9_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO95896.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_176651 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
IIPDCKNGGTLVEENGKFKCNCPLNTFGDDCNCRFKFTNATSLFPKPYAERLVSDSAECD
ENCANDTRCSTSTMTYLKKCKLYETPVIFVSYDEDLCIEKCNEMSECNLTIHLRTHTGEK
PYTCDVCNKSFSQKGNLTTLLRTHTGEKPYTCDVCNKSFSQKGNLTTHLRTHTGEKPYTC
DSKSNLTTHLRTHTGEKPYTCDVYNKSFSEKGNLTTHLRTHTGEKPYTCNLTTHLRTHTG
EKPYTCDVCNKSFSQKGNLTTHLRTHTGEKPYTCDVCNKSFSLKSKSNLTTHLRTHTGEK
PYTCDVCNESFSRKGNLTTHLRTHTREKPYTCDDCN
Download sequence
Identical sequences V4AQF9
XP_009053416.1.39240 jgi|Lotgi1|176651|fgenesh2_pg.C_sca_2356000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]