SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AQZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AQZ6
Domain Number 1 Region: 116-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000058
Family EGF-type module 0.021
Further Details:      
 
Domain Number 2 Region: 87-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000935
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  V4AQZ6
Domain Number - Region: 53-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000319
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 146-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00103
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4AQZ6
Sequence length 238
Comment (tr|V4AQZ6|V4AQZ6_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO96106.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_231837 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MGSFKVYVSMFVLIAMLKSSSSSRYSSRYGSRSRYNYQPSLSQCLSDLERTLCPKANPCK
NGGTEQSDGTCVCTDKFTGTTCEEKVNPCKNGGIDLPNVGCICTADFTGPTCEERVNPCQ
NNGTLLSDGSCNCTVDFTGTLCEEIVNPCQNNGTLLADGSCNCTVAFGGTFCEIVNPCQN
NGTLLADGSCNCTESFGDTFCGQLRCESDPTEPNFCAPECDPEYLVFGFCDGDDICCL
Download sequence
Identical sequences V4AQZ6
XP_009053221.1.39240 jgi|Lotgi1|231837|estExt_fgenesh2_pg.C_sca_230107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]