SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4ATB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4ATB9
Domain Number 1 Region: 439-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000147
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 2 Region: 406-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000628
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  V4ATB9
Domain Number - Region: 643-674
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00014
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 613-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000246
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 675-707
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000249
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 577-610
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000367
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 548-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00776
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 128-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00805
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 708-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00872
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 741-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0487
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4ATB9
Sequence length 801
Comment (tr|V4ATB9|V4ATB9_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO98140.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_52132 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
TEIKTFESGFPVPRRTEEENEVKPIWQRESLMKEADAQFLCASYIVDSPISVACTSIVQQ
SVDTALNLCLQDIQIKKNSSRVKYDLKIVEDMCENSILKDFISYVPPNDFDPVFPLEVQK
SLACPSGCNGRGQCTVKGCVCESFYFGLDCKISVIKWNKTFELCDINLYGCDRVTFFVPK
RNSGFKCKLTLVEYSSDLSNLSMSIGIDLKANEVDCIIPSTKFLRRVFSQSNTERYQIEV
INRRGRVVSDRRFVVYDSRCRHCNKAVHVLLKYENTCYIDGKCYPMQARNIQNRCQQCIP
TVSNYKWTGLEENQPPVFEVTNKQVVRFLEEEVKVLILAYDPEGSETTLTVHHKDAIITE
GNILVWNTAAVERKETPKLELFEVTASDPCNASSVLLIQLIVVSCDCLHNGICANGFDSI
SGPFEYTCSCLPGYTGKLCEVDINDCEPNPCLHGTCIDQLLAYECVCPQGYKGEKACKLG
VCSDLVTCMELRDYPGYSCSPCPKGYSGNGTTSICEPSCGRYRTCYEPNKCKCPDGYAGH
RCHKAICDPKCHKGGFCTKPNVCKCFSGYKGILCEISTCQPSCKNDGKCYSSNRCRCKPG
YGGSRCERVACGFKCFNGGRCIAVNKCKCRPGFYGIFCERKICRPSCLNGGHCTSAGTCR
CPTGYFGKRCQNAICSPPCVHGGKCKRKNTCKCPRGYGGPRCENAICRQGCRNGGRCRAP
DRCMCRSGWRGFKCDKAICDVSCKNSGLCFKPNICACKDGYAGSDCSKPICRPSCKNKGF
CMAPGYCWCNRNHYGKDCSKR
Download sequence
Identical sequences V4ATB9
XP_009051160.1.39240 jgi|Lotgi1|52132|gw1.191.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]