SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AU21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V4AU21
Domain Number - Region: 324-415
Classification Level Classification E-value
Superfamily Prefoldin 0.0128
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4AU21
Sequence length 460
Comment (tr|V4AU21|V4AU21_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP00803.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_205196 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MAFSDITRTPRTPRLSPMMPSMLPYAGDKTTSRHLGRSLDMGQAQAYYNPANKSVYNRYS
VGDWGQSNNSHFNLSSKERSYGERLRADAWRAIQETDSRTRNRQNEVTKRLGERVTDIAF
WKSELNTEINQMATEIENLKEYRRVLEKALGDTANPLHVAEECLMHREKRRGIDLVNDDV
EKSLIKEVQLIKHCQGKMKRVLDKAMAQLKVNRAAQHALEVDCKDKHHAQHLDDRMQQLK
NSSAGIGYFPSIENVDNTITIPESWARYTHENVIRSQKERAASEKLRGEIDSCMRSCANE
MWSIFNAVNNNFNMRIHDTTDARNKLQAHLQRTMQEIFDMERNIHLLRKAIQDKENPMKV
AQTRLDERTRRIHVEVCHDPVMKTLKHEVNDIRESIAILKKSLRESELSLARLMKTKAVL
ENDIGVKENSLKLDSQLCMGMRKGFPMDPKVGPIFQMPTC
Download sequence
Identical sequences V4AU21
jgi|Lotgi1|205196|estExt_fgenesh2_kg.C_sca_1480004 XP_009048509.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]