SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AYB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AYB6
Domain Number 1 Region: 8-189
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-36
Family YWTD domain 0.0000294
Further Details:      
 
Domain Number 2 Region: 196-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4AYB6
Sequence length 235
Comment (tr|V4AYB6|V4AYB6_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP02573.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_138195 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MLIYIFSGVIECYGLSVDWISNHVYWTDSGKRTVEIANYDGSGRRLLVSSGLEKPRGIVV
DPIFKYVFWADQGTRKIERSALDGTERRVLVPDGLQWTNQLAISYATRRLYWSESGVHTL
HYGHITSSNRRELTYLSGSDVFGMAVFDQVLFYSDWYTNSVYMVDMITGDQETIASHLSR
PTSIVIYHPTDLKKDNLCAEDTCSDVCVPVPRSYHCTCHPGSKLAADGKNCILSE
Download sequence
Identical sequences V4AYB6
jgi|Lotgi1|138195|e_gw1.122.42.1 XP_009046713.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]