SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4AZT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4AZT3
Domain Number 1 Region: 421-689
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-52
Family YWTD domain 0.00000153
Further Details:      
 
Domain Number 2 Region: 165-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000681
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 3 Region: 306-414,681-732
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 127-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00046
Further Details:      
 
Domain Number 5 Region: 47-85
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 84-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 7 Region: 215-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 254-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 2-44
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 294-330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4AZT3
Sequence length 821
Comment (tr|V4AZT3|V4AZT3_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP00656.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_112161 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
KFQCPSSQFTCKNSRCIPSSWRCDKDSDCNDGEPGGIGSDEIDCAVTCSDEDQFRCDNGQ
CISSRWQCDRDTDCRDGSDEKPEFCANKTCKEDQFQCGNGACIPRAWMCDGQTDCADDEA
DEKNEECTKVTCKEGEFACKNGRCIEERWMCDQDDDCYDKSDEDPKLCPVQSCETDEFQC
ENKLCVKSSWVCDGDLDCKDGSDEKNCSDTALIGSKCSKTEFVCNGTFECIHMSWRCDGD
ADCTDESDEHDCVITCRSDQFMCVEESYCISDVLKCDGNPDCNDNSDEEGCPTQCKKNEF
DCQGNGKKCIPMHKVCNHQNDCGMFEDEDPERFNFDPCEDKNNRCNQVCVNDYQGGYICQ
CHKGFKLNTTTECIDINECETPGTCSQLCTNTKGSFKCSCEEGYMLDENKHCRVDGKGPQ
LLLANRKDLRRIDIADQRKFDYSLLVKDASVECAIAVDYDIRNNKVYWTDVSMEKILSAD
IDDNTTVTTVADTFVNTPDGIAVDWIHKHLYWTDTGYNKIEVSTLDGKMRRVLIDSDLDE
PRAIVLDPSNGYMYWTDWGENPKIEKCGMDGSNRQVIIQNKPKQNIVIEWPNGITIDYVN
ERLLWLDAKLHKIVSSDYEGNDLRLVHSSHADVHHPYGIAVFEDFIYYTDWKSESVRKMN
KFGIGKPTVVALDLNEPTDVHIFHEYKQPQWSNRCPADHGCQHFCLPSPSDVKYSCVCQN
DFNLNIDKKTCSEIRKQSLPTEKSQFCLFSHVIFSIFQILFVFFKRLRRKNIKSMNFDNP
VYRKTTEEQFAIDKANKLPPVSLYLVFLILLIIASSAYSGS
Download sequence
Identical sequences V4AZT3
jgi|Lotgi1|112161|e_gw1.15.90.1 XP_009048775.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]