SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4B2B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4B2B4
Domain Number 1 Region: 37-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-18
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 2 Region: 149-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4B2B4
Sequence length 221
Comment (tr|V4B2B4|V4B2B4_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO82444.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_170076 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MGGSYTIFLILLFCFYINGEILKLKREKREAIASNVDITATQGSISSPGFQDGVNYPLNV
DKTWTLHLPKDSAYSVTLNITFMDIEEEAKCEWDFLEFDKDYSQRLCGSRTGVYTVESAY
KETKIRFVSDFYMAKRGFTAYYSIERLANPCDKSQCVNNGSCSRLSNSDYKCICSKHYTG
KYCQEFKKSECESYPCLIFEDNFDFINHHVWEHEITLGGGG
Download sequence
Identical sequences V4B2B4
jgi|Lotgi1|170076|fgenesh2_pg.C_sca_92000094 XP_009066947.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]