SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4B2E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4B2E5
Domain Number 1 Region: 23-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000245
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 2 Region: 5-27
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000125
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4B2E5
Sequence length 52
Comment (tr|V4B2E5|V4B2E5_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO82519.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_61096 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
EITESDYICYCVPGFTGRNCQVNIDECTVNPCQQDGLCIDGINNYFCACMKG
Download sequence
Identical sequences V4B2E5
jgi|Lotgi1|61096|gw1.9015.1.1 XP_009066793.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]