SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4B363 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V4B363
Domain Number - Region: 691-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00661
Family Integrin beta EGF-like domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4B363
Sequence length 1232
Comment (tr|V4B363|V4B363_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP04733.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_170568 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MKTSLQPLLIPLAIHLYSFSMILVSDLCGKKQYLPFTHQTKRSVNYDKTTTFTDRFMREG
WYGSQDFIIPFVKPKRRHCGAIYPIFLQREPGFEKVIEDVTACILDCTYTMSIKALRCSP
RLTIYKLTRPLNSNAAYCLDGFETGTELLDFDTNVTIDTNIRLVNGSEYEKEFSFKCSFP
NPNQDSLVYKATWFVDDMMVYESYYTNYDDCDAVRSLTDTRLRDSNITTLGFQLHCNIRA
ANSINGKWMSSLPSTSRKKFIGMEVENPVINIKEGEQTTIKIRSTVPIGCFEPEGCTLTV
TADIPQDADKKCEPTPTANGINIVKDTSLIQGKTCKMYSDPYLEDFYTHMGKSSFQMEGT
FYLLQMDNVEVQLTDCATVGGGSCVCGVVVRVGRTAFMINHCNLENWYIDYILCDDGGDI
LDVRKKDETTFELFLPTDTKISITQIENSNIHWLNIYIYPSVRDIGKTSGLCGELTANPP
SVQYDDAYFKSFRVRADVSLFDPGNWRTLPEWASNNTVRFQHCRCDERVAGGIDTSLNCS
PVPGATTCSSDTDYTLFHKKKCINPLRKKRSLPLGLQPQILLHRRLRRDVSWKNGWTMDS
ANEYCSGLFNNSMVIKRCEGIRGINIEGAIETCVSDIQLSGTDVFALSAISSVSSQCLRE
ARMNGTLREKKVDSNKTILELVKEVACPGECSDQGLCENGKCICNSEFIGSDCSVSLNEP
PLAHNLEADGHCDLSQDDCTDVAVFGGRFVDAEQTKCQLLPFEIKNDQVIISEERIIQTA
VFESIGEVTCKLPSRKRRRRSVDVPVIDETVTGYKVSVSNNGQNYSQQLNFIIYNTECIN
CSIDNSDKMNCSFSVNYCIIDAICYSNGLFQSNYCIIDAICYSNGLFQSNYCIIDAICYS
NSLFQSNYCIIDAICYSNGLFQSNYCIIDAIYYSNGLFQSNYCIIDAICYSNGLFQSNYC
IIDSIYYSNGLFQSNYCIIDAICYSNGLFQSNYCIIDAICYSNGLFQSNYCIIDAICYSN
SLFQSNCCIIDAICYSNGLFQSNYCIIDTLCYSNGLFQFNYCIIDAICYSNGLFQSNYCI
IDAIYYSNGLFQSNYCIIDAICYNAICYSNGLYQSNYCIIDAICYSNGLFQSNYCIIETI
CYSNGLFQSNYCIIDAICYSNGLFQPDHCIMHNRCYGNGTIYNTGDREFICRADSNVKAW
HPDESDVQTQSTTPRNESPTFLCIVLNIFCNE
Download sequence
Identical sequences V4B363
XP_009044632.1.39240 jgi|Lotgi1|170568|fgenesh2_pg.C_sca_100000063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]