SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4B7V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4B7V9
Domain Number 1 Region: 431-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000694
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  V4B7V9
Domain Number - Region: 122-209
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0471
Family Tricorn protease N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4B7V9
Sequence length 860
Comment (tr|V4B7V9|V4B7V9_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP03706.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_171136 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MEMRNFLKFLILWCLPLCRGLGLDQWGNHFYLSFLVNVQNSDYIYLNVIVITTREQTTVR
INLNKLNTPVTEITLAPGQSYNLVLDESYKAVPVLEVIPKKAVVITSSAPVSVYGFTGRQ
TSNEGYLTLPVPSLGKQYIVVNYENGRPQIVVIAIEDGTTVTITLKGDNKCFYINGFKDY
VDGYAFTFTMNDADVVNIYCLYDSTGSIVASNKPVAMLSGNRCADIPSQSRCDHLVEMLP
PVSELGTKFIVVAPDFQTYNAAMRVVATQSSTTFTIKGIDYVLGNSDFQELSLIKGEVVC
FTSNKPVLVVVYMGGKDVDNGIDTYYHGDPLMMVVPPVDKYTTQYVMDSAQLNYNNIYAI
LVSQKESTNLITPSVTSGWSDVCSDHAYVIKSVSGFVSYESSDSLMVWMYGTEIRGGFGF
PGGFGLSDYSGVNECATNPCQNDGWCLEVGTTTRCNCGLEYTGSLCETVITTTAEPSTTT
EPSTTTEPSTTTEPTTTTEPTTTTEPTTTTEPSTTTEPTSTTEPTTTTEPTTTTEPTTTT
EPTTTTEPITTTEPTTTTEPTTTTEPTTTTVPTTTTEPSTTTEPTTTTEPTTTTEPTTTT
EPTTTTEPTTTTELTTTTEPTTTTETTTTTEPTTTTEPTTAEPTTSTEPTTTTEPNTTTE
PNTTTEPTTEPTASTEPTTTTEPNTTTEPNTTTEPNTTTEPTTEPTASAEPTTTTGATTT
TELTTTTELTTDEANFKPIFHKPCKLGSCQCACPCKIGTVTKLERVQNASKQIAKKLILP
KQTLSKTKRTKTSVYNTNQTEETLGISSFVFLGLFLLVFLLLDIPVNRIVNWIQMIGSGR
TRKRLNQANDSNHRRQYVSD
Download sequence
Identical sequences V4B7V9
XP_009045563.1.39240 jgi|Lotgi1|171136|fgenesh2_pg.C_sca_110000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]