SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4BB36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4BB36
Domain Number 1 Region: 245-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000287
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  V4BB36
Domain Number - Region: 186-278
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00879
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 71-107
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 0.0379
Family Chemosensory protein Csp2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4BB36
Sequence length 682
Comment (tr|V4BB36|V4BB36_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO86194.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_235548 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MKIVTVMWILRIGFTKTIADDHQAIRMKKATKVVMVTKLHVPVTFTEIVDDQNVLQVTSE
ISRSVSLADNYKSVGQCHFNEQGPCHYSTEYYKLLVKSVVLSECEKCHILISVSFTLNHT
GLLGYLKISNILKSGFLSFGESLKKLEKSLNQTPLLTYQQRYYRVLDFLMMHTFLRRLCV
VALCLGYIKASADFDCRRTSQSCVTGTCNDVNGDCDCPTDANGVATHRNADCGLEIAKVV
PTALCGPPCLNGGECYEPTVGTYMCMCPEAFYGNKCENPRKKVECSGTEITINYMPIPTF
SGDIFILDNRNTPECAFTEANGMYTATFTYQQCGVTTTNDEPNAGDTSYEISAAVRFNAN
IERATDMKLTAKCVIDGTGQSNLNDNIGTVSVDQRTDLTEETALTEYQPVSFQLQGKNGN
PMPVPVNLGDELRIYIPLADTGRYTKLKITELQTNNGMVEQDLVMETLIFNGCLTDIGEA
LVTGDISSDPAIPAIIINFMAFRLRGSPQVKFDARVQVCEGTDTSCDSVVCPSPPQSVPS
NPQNIPPANPQNIPPANPQNIPPANPQISPSSSQRKRRAAPDNEVILHETLTVLDPRSNE
KLRLPHNKSDIKSQQNADPQQCLQSTEIMVMVIVLIVAVVLLLVITTCLAVKFMKQRAAQ
VKIYNPDMPTGNNTVRIPRAAC
Download sequence
Identical sequences V4BB36
jgi|Lotgi1|235548|estExt_fgenesh2_pg.C_sca_660065 XP_009063153.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]