SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4BC72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4BC72
Domain Number 1 Region: 413-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000779
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4BC72
Sequence length 670
Comment (tr|V4BC72|V4BC72_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP03707.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_171137 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MAAALILSIILGLICQINGLDTDHWGTYFVTSFIRHSPGADYIIIITTREVSRVKITDHG
SGYTNFVTIGANKSHAEVFNDTVIPVSSLEVIESMAISVESSVKVSVYGFSNFLRSSDGF
LVLPVATLGTEYLAINYDQGFPQILVAAVENKTIVDIEMTVPNICLYNSTPQVFNIGEVF
TFTMDEFDLIPVYCARDCTGMKITANKPVAVLSGNLCVKIPATSVCDHIAEMLTPTSEFG
TLFIIVSPIGQDHISFFRVLALENETTVFTGNANFTIDAYKHITFGAPTGVNQCLNTTKP
VLVAQYMTGRTAITQSENYTGDGYMVLIPPVDRYPTNYVIDTSFLHNDVISYMVTIFDWD
VDSCLYGYTVNEISGIHTNSTRNSMGVIIYGVDFRAGYAYLAGLKLTSFSGQEKCKKKPC
KNGGWCLEMSFGYKCRCFKGFTGTQCNMTDISNQVHSQVYSEVPDTIALKTLTASPTSTL
VADQLSDLTMNPTSFVSSTLSPFIRESESDSYELSIPSEEDYTTESLLITQSDRPSHGSG
DLNVFENSFTTVFKIPETEIFEASEIWNEESLSKLFPNGIETTQYSPPKSSHLEIMSSSI
PLIEPSTFIVDKNTVSKTFYLKNSAVNRKESEKDLGIVSVLFVIIITSVVIISDITSYFQ
NEYSQLRKSG
Download sequence
Identical sequences V4BC72
jgi|Lotgi1|171137|fgenesh2_pg.C_sca_110000003 XP_009045564.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]